PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009621672.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 317aa    MW: 36915.6 Da    PI: 8.5411
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009621672.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.92.5e-50421722128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                      pGfrFhPtdeelv +yL++kve+k++++ e ik++diyk++PwdLp++ + ++kewyfF+ r +ky+++ r+nr+t+sg+Wkatg dk+v+s++
  XP_009621672.1  42 LPGFRFHPTDEELVGFYLRRKVENKRINI-ELIKQIDIYKYDPWDLPRASTIGDKEWYFFCMRGRKYKNSVRPNRVTRSGFWKATGIDKPVYSTT 135
                     69***************************.89***************877889****************************************84 PP

             NAM  97 gel.....vglkktLvfykgrapkgektdWvmheyrl 128
                     +++     +glkk Lv+y+g+a kg+k+dW+mhe+rl
  XP_009621672.1 136 KSQnhdciIGLKKCLVYYRGSAGKGTKSDWMMHEFRL 172
                     44456777***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-5440200IPR003441NAC domain
PROSITE profilePS5100552.52741201IPR003441NAC domain
PfamPF023657.2E-2643172IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005992Biological Processtrehalose biosynthetic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006561Biological Processproline biosynthetic process
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010120Biological Processcamalexin biosynthetic process
GO:0042538Biological Processhyperosmotic salinity response
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MHVIESKMNR VKKGQEKSEV MELKDVAVAK IIKDGDEEEV TLPGFRFHPT DEELVGFYLR  60
RKVENKRINI ELIKQIDIYK YDPWDLPRAS TIGDKEWYFF CMRGRKYKNS VRPNRVTRSG  120
FWKATGIDKP VYSTTKSQNH DCIIGLKKCL VYYRGSAGKG TKSDWMMHEF RLPPTWKTTS  180
NNQLQNTHEA EVWTLCRIFK RTSNYKRYTP EGKHPLVSLS FGNASPKTCS LESENSGVHS  240
TSFKQVSFPQ ENNNGDDNLM DERNHHFYQQ HLFTSSSSSF WNTNISEEED LFSDGKWDEL  300
KSVVDLATDP SSLYRCM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-49332077174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00310DAPTransfer from AT2G43000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009621672.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK553e-98NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLK4CER11e-122K4CER1_SOLLC; Uncharacterized protein
STRINGSolyc07g045030.2.11e-121(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16972469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.14e-98NAC domain containing protein 42